AP3D1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13058T
Article Name: AP3D1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13058T
Supplier Catalog Number: CNA13058T
Alternative Catalog Number: MBL-CNA13058T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 520-700 of human AP3D1 (NP_003929.4).
Conjugation: Unconjugated
Alternative Names: ADTD, HPS10, hBLVR
Clonality: Polyclonal
Molecular Weight: 130kDa
NCBI: 8943
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AVYVQNVVKLYASILQQKEQAGEAEGAQAVTQLMVDRLPQFVQSADLEVQERASCILQLVKHIQKLQAKDVPVAEEVSALFAGELNPVAPKAQKKVPVPEGLDLDAWINEPLSDSESEDERPRAVFHEEEQRRPKHRPSEADEEELARRREARKQEQANNPFYIKSSPSPQKRYQDTPGVE
Target: AP3D1
Application Dilute: WB: WB,1:500 - 1:2000