PITPNM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13063T
Article Name: PITPNM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13063T
Supplier Catalog Number: CNA13063T
Alternative Catalog Number: MBL-CNA13063T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human PITPNM1 (NP_004901.2).
Conjugation: Unconjugated
Alternative Names: Rd9, NIR2, RDGB, DRES9, RDGB1, RDGBA, PITPNM, RDGBA1
Clonality: Polyclonal
Molecular Weight: 135kDa
NCBI: 9600
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTAAQTGPLMCAY
Target: PITPNM1
Application Dilute: WB: WB,1:500 - 1:2000