ACOT8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13067T
Article Name: ACOT8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13067T
Supplier Catalog Number: CNA13067T
Alternative Catalog Number: MBL-CNA13067T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ACOT8 (NP_005460.2).
Conjugation: Unconjugated
Alternative Names: hTE, NAP1, PTE1, PTE2, PTE-1, PTE-2, HNAACTE, hACTE-III
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 10005
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDM
Target: ACOT8
Application Dilute: WB: WB,1:500 - 1:2000