NUP160 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13080T
Article Name: NUP160 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13080T
Supplier Catalog Number: CNA13080T
Alternative Catalog Number: MBL-CNA13080T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human NUP160 (NP_056046.1).
Conjugation: Unconjugated
Alternative Names: NPHS19
Clonality: Polyclonal
Molecular Weight: 162kDa
NCBI: 23279
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNR
Target: NUP160
Application Dilute: WB: WB,1:500 - 1:2000