VPS39 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13082T
Article Name: VPS39 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13082T
Supplier Catalog Number: CNA13082T
Alternative Catalog Number: MBL-CNA13082T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 606-875 of human VPS39 (NP_056104.2).
Conjugation: Unconjugated
Alternative Names: TLP, VAM6, hVam6p
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 23339
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RFHNCLIQLYCEKVQGLMKEYLLSFPAGKTPVPAGEEEGELGEYRQKLLMFLEISSYYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHILKDTRMAEEYCHKHYDRNKDGNKDVYLSLLRMYLSPPSIHCLGPIKLELLEPKANLQAALQVLELHHSKLDTTKALNLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQQVKCIITEEKVCMVCKKKIGNSAFARYPNG
Target: VPS39
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200