AADAT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13090T
Article Name: AADAT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13090T
Supplier Catalog Number: CNA13090T
Alternative Catalog Number: MBL-CNA13090T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 34-429 of human AADAT (NP_001273611.1).
Conjugation: Unconjugated
Alternative Names: KAT2, KATII, KYAT2
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 51166
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIER
Target: AADAT
Application Dilute: WB: WB,1:2000 - 1:4000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200