LARP7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13095T
Article Name: LARP7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13095T
Supplier Catalog Number: CNA13095T
Alternative Catalog Number: MBL-CNA13095T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-380 of human LARP7 (NP_057732.2).
Conjugation: Unconjugated
Alternative Names: ALAZS, PIP7S, hLARP7, HDCMA18P
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 51574
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKENRDIEISTEEEKDTGDLKDSSLLKTKRKHKKKHKERHKMGEEVIPLRVLS
Target: LARP7
Application Dilute: WB: WB,1:500 - 1:2000