YY1AP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13104T
Article Name: YY1AP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13104T
Supplier Catalog Number: CNA13104T
Alternative Catalog Number: MBL-CNA13104T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human YY1AP1 (NP_060723.2).
Conjugation: Unconjugated
Alternative Names: GRNG, HCCA1, HCCA2, YY1AP
Clonality: Polyclonal
Molecular Weight: 88kDa
NCBI: 55249
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQT
Target: YY1AP1
Application Dilute: WB: WB,1:500 - 1:2000