HFE Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1310S
Article Name: HFE Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1310S
Supplier Catalog Number: CNA1310S
Alternative Catalog Number: MBL-CNA1310S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-306 of human HFE (NP_000401.1).
Conjugation: Unconjugated
Alternative Names: HH, HFE1, HLA-H, MVCD7, TFQTL2
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 3077
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLV
Target: HFE
Application Dilute: WB: WB,1:500 - 1:2000