REG4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13129T
Article Name: REG4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13129T
Supplier Catalog Number: CNA13129T
Alternative Catalog Number: MBL-CNA13129T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-158 of human REG4 (NP_114433.1).
Conjugation: Unconjugated
Alternative Names: GISP, RELP, REG-IV
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 83998
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Target: REG4
Application Dilute: WB: WB,1:500 - 1:1000