VPS25 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13132T
Article Name: VPS25 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13132T
Supplier Catalog Number: CNA13132T
Alternative Catalog Number: MBL-CNA13132T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human VPS25 (NP_115729.1).
Conjugation: Unconjugated
Alternative Names: DERP9, EAP20, FAP20
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 84313
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Target: VPS25
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200