NEXN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13136T
Article Name: NEXN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13136T
Supplier Catalog Number: CNA13136T
Alternative Catalog Number: MBL-CNA13136T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 516-675 of human NEXN (NP_653174.3).
Conjugation: Unconjugated
Alternative Names: CMH20, NELIN
Clonality: Polyclonal
Molecular Weight: 81kDa
NCBI: 91624
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RFEQMAKAREEEEQRRIEEQKLLRMQFEQREIDAALQKKREEEEEEEGSIMNGSTAEDEEQTRSGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDGGEYMCKAVNNKGSAASTCILTIESKN
Target: NEXN
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200