SCGB3A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13137T
Article Name: SCGB3A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13137T
Supplier Catalog Number: CNA13137T
Alternative Catalog Number: MBL-CNA13137T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human SCGB3A2 (NP_473364.1).
Conjugation: Unconjugated
Alternative Names: LU103, PNSP1, UGRP1, pnSP-1
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 117156
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
Target: SCGB3A2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200