UNC13D Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA13141T
| Article Name: |
UNC13D Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA13141T |
| Supplier Catalog Number: |
CNA13141T |
| Alternative Catalog Number: |
MBL-CNA13141T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 891-1090 of human UNC13D (NP_954712.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
FHL3, HLH3, HPLH3, Munc13-4 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
123kDa |
| NCBI: |
201294 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
LIRKYFCSRIQQQAETTSEELGAVTVKASYRASEQKLRVELLSASSLLPLDSNGSSDPFVQLTLEPRHEFPELAARETQKHKKDLHPLFDETFEFLVPAEPCRKAGACLLLTVLDYDTLGADDLEGEAFLPLREVPGLSGSEEPGEVPQTRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRAKQASQHALRPAP |
| Target: |
UNC13D |
| Application Dilute: |
WB: WB,1:1000 - 1:2000 |
