MRGPRX1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13142T
Article Name: MRGPRX1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13142T
Supplier Catalog Number: CNA13142T
Alternative Catalog Number: MBL-CNA13142T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 263-322 of human MRGPRX1 (NP_671732.3).
Conjugation: Unconjugated
Alternative Names: GPCR, MGRG2, MRGX1, SNSR4
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 259249
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ
Target: MRGPRX1
Application Dilute: WB: WB,1:500 - 1:2000