FMN1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13143T
Article Name: FMN1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13143T
Supplier Catalog Number: CNA13143T
Alternative Catalog Number: MBL-CNA13143T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-495 of human FMN1 (NP_001096654.1).
Conjugation: Unconjugated
Alternative Names: LD, FMN
Clonality: Polyclonal
Molecular Weight: 158kDa
NCBI: 342184
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: NIDMPKTEPKGADPESPRREEMGCNADQESQSGPGVPQTQGGEVKPKSPETALEAFKALFIRPPRKGTTADTSELEALKRKMRHEKESLRAVFERSNSKPADGPSDSKSPDHSLTEQDDRTPGRLQAVWPPPKTKDTEEKVGLKYT
Target: FMN1
Application Dilute: WB: WB,1:500 - 1:2000