RBM14 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13159T
Article Name: RBM14 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13159T
Supplier Catalog Number: CNA13159T
Alternative Catalog Number: MBL-CNA13159T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human RBM14 (NP_006319.1).
Conjugation: Unconjugated
Alternative Names: SIP, COAA, PSP2, SYTIP1, TMEM137
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 10432
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS
Target: RBM14
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:100 - 1:500