U2AF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13166T
Article Name: U2AF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13166T
Supplier Catalog Number: CNA13166T
Alternative Catalog Number: MBL-CNA13166T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1).
Conjugation: Unconjugated
Alternative Names: RN, FP793, U2AF35, U2AFBP, RNU2AF1
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 7307
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
Target: U2AF1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IP,1:500 - 1:1000