SREK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13235T
Article Name: SREK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13235T
Supplier Catalog Number: CNA13235T
Alternative Catalog Number: MBL-CNA13235T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SREK1 (NP_631907.1).
Conjugation: Unconjugated
Alternative Names: SFRS12, SRrp86, SRrp508
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 140890
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPE
Target: SREK1
Application Dilute: WB: WB,1:500 - 1:2000