TBCB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13248T
Article Name: TBCB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13248T
Supplier Catalog Number: CNA13248T
Alternative Catalog Number: MBL-CNA13248T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-244 of human TBCB (NP_001272.2).
Conjugation: Unconjugated
Alternative Names: CG22, CKAP1, CKAPI
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 1155
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Target: TBCB
Application Dilute: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200