TNFRSF11B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13250P
Article Name: TNFRSF11B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13250P
Supplier Catalog Number: CNA13250P
Alternative Catalog Number: MBL-CNA13250P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-280 of human TNFRSF11B (NP_002537.3).
Conjugation: Unconjugated
Alternative Names: OPG, TR1, OCIF, PDB5
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 4982
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDID
Target: TNFRSF11B
Application Dilute: WB: WB,1:500 - 1:2000