Podoplanin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13261P
Article Name: Podoplanin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13261P
Supplier Catalog Number: CNA13261P
Alternative Catalog Number: MBL-CNA13261P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 99-199 of human Podoplanin (NP_006465.3).
Conjugation: Unconjugated
Alternative Names: T1A, GP36, GP40, Gp38, OTS8, T1A2, TI1A, D2-40, T1A-2, AGGRUS, HT1A-1, PA2.26
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 10630
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK
Target: PDPN
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200