AGER Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13264P
Article Name: AGER Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13264P
Supplier Catalog Number: CNA13264P
Alternative Catalog Number: MBL-CNA13264P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-210 of human AGER (NP_001127.1).
Conjugation: Unconjugated
Alternative Names: RAGE, sRAGE, SCARJ1
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 177
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSF
Target: AGER
Application Dilute: WB: WB,1:5000 - 1:10000