Cystatin C Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA13291S
| Article Name: |
Cystatin C Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA13291S |
| Supplier Catalog Number: |
CNA13291S |
| Alternative Catalog Number: |
MBL-CNA13291S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 27-146 of human Cystatin C (NP_000090.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ARMD11, HEL-S-2 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
13kDa |
| NCBI: |
1471 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA |
| Target: |
CST3 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
