Desmoplakin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13299S
Article Name: Desmoplakin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13299S
Supplier Catalog Number: CNA13299S
Alternative Catalog Number: MBL-CNA13299S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2750-2850 of human Desmoplakin (NP_004406.2).
Conjugation: Unconjugated
Alternative Names: DP, DCWHKTA
Clonality: Polyclonal
Molecular Weight: 332kDa
NCBI: 1832
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: AIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSF
Target: DSP
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200