GARS Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13305S
Article Name: GARS Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13305S
Supplier Catalog Number: CNA13305S
Alternative Catalog Number: MBL-CNA13305S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-370 of human GARS (NP_002038.2).
Conjugation: Unconjugated
Alternative Names: GARS, HMN5, CMT2D, DSMAV, GlyRS, HMN5A, SMAD1, SMAJI
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 2617
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: AEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLE
Target: GARS1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200