Albumin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1363S
Article Name: Albumin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1363S
Supplier Catalog Number: CNA1363S
Alternative Catalog Number: MBL-CNA1363S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-247 of human Albumin (NP_000468.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 213
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRF
Target: ALB
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200