Glucocorticoid Receptor Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13667P
Article Name: Glucocorticoid Receptor Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13667P
Supplier Catalog Number: CNA13667P
Alternative Catalog Number: MBL-CNA13667P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Glucocorticoid Receptor (NP_001191194.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 2908
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTK
Target: NR3C1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200