PDHA1 Rabbit mAb, Clone: [ARC0722], Unconjugated, Monoclonal

Catalog Number: MBL-CNA13687S
Article Name: PDHA1 Rabbit mAb, Clone: [ARC0722], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA13687S
Supplier Catalog Number: CNA13687S
Alternative Catalog Number: MBL-CNA13687S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PDHA1 (P08559).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0722]
Molecular Weight: 43kDa
NCBI: 5160
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKG
Target: PDHA1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200