TNFAIP8L2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13698T
Article Name: TNFAIP8L2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13698T
Supplier Catalog Number: CNA13698T
Alternative Catalog Number: MBL-CNA13698T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 79626
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Target: TNFAIP8L2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000