RND1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13705T
Article Name: RND1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13705T
Supplier Catalog Number: CNA13705T
Alternative Catalog Number: MBL-CNA13705T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-232 of human RND1 (NP_055285.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 27289
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Target: RND1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200