CYP17A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1373S
Article Name: CYP17A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1373S
Supplier Catalog Number: CNA1373S
Alternative Catalog Number: MBL-CNA1373S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 209-508 of human CYP17A1 (NP_000093.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 1586
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQR
Target: CYP17A1
Application Dilute: WB: WB,1:500 - 1:2000