IDH3B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13742T
Article Name: IDH3B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13742T
Supplier Catalog Number: CNA13742T
Alternative Catalog Number: MBL-CNA13742T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-170 of human IDH3B (NP_008830.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 3420
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGE
Target: IDH3B
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100