EDC3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13763T
Article Name: EDC3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13763T
Supplier Catalog Number: CNA13763T
Alternative Catalog Number: MBL-CNA13763T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 159-508 of human EDC3 (NP_079359.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 80153
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLD
Target: EDC3
Application Dilute: WB: WB,1:500 - 1:2000