EZH2/KMT6 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA13867T
| Article Name: |
EZH2/KMT6 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA13867T |
| Supplier Catalog Number: |
CNA13867T |
| Alternative Catalog Number: |
MBL-CNA13867T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IP, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human EZH2/KMT6 (NP_001190176.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
85kDa |
| NCBI: |
2146 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
LERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELI |
| Target: |
EZH2 |
| Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:50 - 1:100 |
