FCGR2A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1388P
Article Name: FCGR2A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1388P
Supplier Catalog Number: CNA1388P
Alternative Catalog Number: MBL-CNA1388P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FCGR2A (NP_001129691.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 2212
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKP
Target: FCGR2A
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200