RhoA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13947T
Article Name: RhoA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13947T
Supplier Catalog Number: CNA13947T
Alternative Catalog Number: MBL-CNA13947T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 94-193 of human RhoA (NP_001655.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 387
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: NIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Target: RHOA
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:100 - 1:500