CD152/CTLA-4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA13966S
| Article Name: |
CD152/CTLA-4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA13966S |
| Supplier Catalog Number: |
CNA13966S |
| Alternative Catalog Number: |
MBL-CNA13966S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 16-66 of human CD152/CTLA-4 (NP_005205.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
25kDa |
| NCBI: |
1493 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
ATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKA |
| Target: |
CTLA4 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
