DGKA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA13969P
Article Name: DGKA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA13969P
Supplier Catalog Number: CNA13969P
Alternative Catalog Number: MBL-CNA13969P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 1606
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTL
Target: DGKA
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200