PPL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14051S
Article Name: PPL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14051S
Supplier Catalog Number: CNA14051S
Alternative Catalog Number: MBL-CNA14051S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PPL (NP_002696.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 205kDa
NCBI: 5493
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDVTLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVK
Target: PPL
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:100 - 1:500