Apolipoprotein C3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1409P
Article Name: Apolipoprotein C3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1409P
Supplier Catalog Number: CNA1409P
Alternative Catalog Number: MBL-CNA1409P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-99 of human Apolipoprotein C3 (NP_000031.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 345
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Target: APOC3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200