IGF2BP2/IMP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14103S
Article Name: IGF2BP2/IMP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14103S
Supplier Catalog Number: CNA14103S
Alternative Catalog Number: MBL-CNA14103S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human IGF2BP2/IMP2 (NP_006539.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 10644
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
Target: IGF2BP2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500