STIP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14106S
Article Name: STIP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14106S
Supplier Catalog Number: CNA14106S
Alternative Catalog Number: MBL-CNA14106S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Monkey, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human STIP1 (NP_006810.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 10963
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKEL
Target: STIP1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50