Serotonin transporter Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14171P
Article Name: Serotonin transporter Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14171P
Supplier Catalog Number: CNA14171P
Alternative Catalog Number: MBL-CNA14171P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human Serotonin transporter (NP_001036.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 6532
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: AVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV
Target: SLC6A4
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200