PKC zeta Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA14178T
| Article Name: |
PKC zeta Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA14178T |
| Supplier Catalog Number: |
CNA14178T |
| Alternative Catalog Number: |
MBL-CNA14178T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 476-547 of human PKC zeta (NP_002735.3). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
68kDa |
| NCBI: |
5590 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
RIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDN |
| Target: |
PRKCZ |
| Application Dilute: |
WB: WB,1:100 - 1:500 |
