MYL2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14188S
Article Name: MYL2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14188S
Supplier Catalog Number: CNA14188S
Alternative Catalog Number: MBL-CNA14188S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human MYL2 (P10916).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 4633
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Target: MYL2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200