TNFRSF25 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14261T
Article Name: TNFRSF25 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14261T
Supplier Catalog Number: CNA14261T
Alternative Catalog Number: MBL-CNA14261T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-190 of human TNFRSF25 (NP_683866.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 8718
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTPPPSLAGAP
Target: TNFRSF25
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200