ADH1B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1431S
Article Name: ADH1B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1431S
Supplier Catalog Number: CNA1431S
Alternative Catalog Number: MBL-CNA1431S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 206-375 of human ADH1B (NP_000659.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 125
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LSAVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF
Target: ADH1B
Application Dilute: WB: WB,1:500 - 1:2000