RRP36 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14328T
Article Name: RRP36 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14328T
Supplier Catalog Number: CNA14328T
Alternative Catalog Number: MBL-CNA14328T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-259 of human RRP36 (NP_149103.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 88745
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHL
Target: RRP36
Application Dilute: WB: WB,1:500 - 1:2000