LHPP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14342T
Article Name: LHPP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14342T
Supplier Catalog Number: CNA14342T
Alternative Catalog Number: MBL-CNA14342T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human LHPP (NP_071409.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 64077
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYV
Target: LHPP
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200